PTGFR Membrane Protein Introduction

Introduction of PTGFR

PTGFR, also known as Prostaglandin F receptor (FP), is a receptor belonging to the prostaglandin (PG) group of receptors. PTGFR binds to and mediates the biological actions of Prostaglandin F_2α (PGF_2α). It is encoded by the PTGFR gene in humans. PTGFR is expressed as two alternatively spliced transcript variants encoding different isoforms, FPA and FPB, which have different C-terminal lengths. In certain cells, activation of PTGFR also stimulates G12/G13-Gβγ G proteins to activate the Rho family of GTPases signaling proteins and Gi-Gβγ G proteins to activate Raf/MEK/mitogen-activated kinase pathways.

Basic Information of PTGFR
Protein Name	Prostaglandin F2-alpha receptor
Gene Name	PTGFR
Aliases	Prostaglandin F2-alpha receptor, PGF receptor, PGF2-alpha receptor, Prostanoid FP receptor
Organism	Homo sapiens (Human)
UniProt ID	P43088
Transmembrane Times	7
Length (aa)	359
Sequence	MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMK AYQRFRQKSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNV LCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGV CLFAVFIALLPILGHRDYKIQASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLA LGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMVIQLLAIMCVSCICWSPF LVTMANIGINGNHSLETCETTLFALRMATWNQILDPWVYILLRKAVLKNLYKL ASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST

Function of PTGFR Membrane Protein

This PTGFR receptor serves a variety of functions. It has been regarded as the most successful therapeutic target among the 9 prostanoid receptors. One side effect of applying PTGFR receptor agonists to eyelashes in humans is the development of hyperpigmentation at nearby skin sites. Studies have suggested that PTGFR receptor activation may be a useful means to increase skin pigmentation. Besides, PGF_2α causes airway constriction in normal and asthmatic humans and its presence in human sputum is related to sputum eosinophil levels. Thus, activation of PTGFR has pathophysiological consequences for the cardiovascular system relative to blood pressure, cardiac function, and atherosclerosis in animal models.

Fig.1 Structure of PTGFR membrane protein.

Application of PTGFR Membrane Protein in Literature

Xiao B., et al. Rare SNP rs12731181 in the miR-590-3p Target Site of the Prostaglandin F2α Receptor Gene Confers Risk for Essential Hypertension in the Han Chinese Population. Arterioscler Thromb Vasc Biol. 2015, 35(7): 1687-1695. PubMed ID: 25977569

The article indicates that rs12731181 in the seed region of the miR-590-3p target site is associated with an increased risk of essential hypertension and represents a new paradigm for FP involvement in blood pressure regulation.
Hay A., et al. Labour is associated with decreased expression of the PGF2alpha receptor (PTGFR) and a novel PTGFR splice variant in human myometrium but not decidua. Mol Hum Reprod. 2010, 16(10): 752-760. PubMed ID:20519365

This article suggests that the role of the PTGFR in the human uterus requires further validation prior to pursuing it as a target for the treatment of preterm labor.
Keightley M.C., et al. F-Prostaglandin receptor regulates endothelial cell function via fibroblast growth factor-2. BMC Cell Biol. 2010, 11(1): 8. PubMed ID:20092633

The article reveals that prostaglandin F(2alpha) can directly regulate endothelial cell network formation but not endothelial cell proliferation.
Errasti A.E., et al. Expression and functional evidence of the prostaglandin F2alpha receptor mediating contraction in human umbilical vein. Eur J Pharmacol. 2009, 610(1-3): 68-74. PubMed ID:19289115

The article proposes for the first time that human umbilical vein express prostanoid FP-receptors and these receptors could be involved in the vasoconstriction action of PGF(2alpha) in this tissue.
Sakurai M., et al. Association between genetic polymorphisms of the prostaglandin F2α receptor gene, and response to latanoprost in patients with glaucoma and ocular hypertension. Br J Ophthalmol. 2014. PubMed ID:24457363

The article concludes that an association was found between SNPs of the FP receptor gene and the response to latanoprost in patients with glaucoma or OH. The FP receptor genetic polymorphism may influence the degree of IOP reduction by latanoprost in these patients.

PTGFR Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-PTGDR antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: