SLC9B1 Membrane Protein Introduction

Introduction of SLC9B1

SLC9B1, the full protein name is sodium/hydrogen exchanger 9B1, it’s also known as NHA1 or NHEDC1. SLC9B1 belongs to solute carrier family 9, subfamily B, and is encoded by the SLC9B1 gene in humans. It’s broadly expressed in testis, kidney and 17 other tissues. SLC9B1 is highly conservative in other mammalian species. It functions as a sodium/hydrogen exchanger. Multiple transcript variants encoding different isoforms have been found for this gene.

Basic Information of SLC9B1
Protein Name	Sodium/hydrogen exchanger 9B1
Gene Name	SLC9B1
Aliases	NHA1, NHEDC1
Organism	Homo sapiens (Human)
UniProt ID	Q4ZJI4
Transmembrane Times	13
Length (aa)	515
Sequence	MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAQEETKTVLSDTEEIKPQTKKETYISCPLRGVLNVIITNGVILFVIWCMTWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVPFINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFPWQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGILNNAIASIRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVLSFIAGTKWSQEKMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLMCFAGFSFKEKIFIALAWMPKATVQAVLGPLALETARVSAPHLEPYAKDVMTVAFLAILITAPNGALLMGILGPKMLTRHYDPSKIKLQLSTLEHH

Function of SLC9B1 Membrane Protein

SLC9B1 is also known as NHA1, which belongs to proton exchangers and transporters family. It was identified specifically in testis for the first time in 2006, and it’s highly conserved in mammals including human, mouse, Macaca fascicularis and rat. Its family - SLC9B (including SLC9B1 and SLC9B2 members) belongs to the sodium/lithium hydrogen antiporter family, and plays the functions as solute exchangers within cellular membranes of mammalian tissues. SLC9B1 is a sperm-specific sodium/hydrogen exchanger involved in maintaining pH homeostasis of spermatozoa. Except for this, SLC9B1 also plays an important role in sperm motility and fertility. After that, SLC9B1 is found to be necessary for survival and shows different transporting functions compared with SLC9B2. In addition, the expression level of SLC9B1 can be regulated by DNA methylation-related mechanisms. Furthermore, DNA methylation patterns of SLC9B1 can predict fetal intolerance of labor.

Fig.1 SLC9B1 acts as an H⁺-Cl^- cotransporter. (Chintapalli, 2015)

Application of SLC9B1 Membrane Protein in Literature

Knight A.K., et al. SLC9B1 methylation predicts fetal intolerance of labor. Epigenetics. 2018, 13(1): 33-39. PubMed ID: 29235940

This article indicates that DNA methylation patterns of SLC9B1 can predict fetal intolerance of labor.
Holmes R.S., et al. Evolution of Vertebrate Solute Carrier Family 9B Genes and Proteins (SLC9B): Evidence for a Marsupial Origin for Testis Specific SLC9B1 from an Ancestral Vertebrate SLC9B2 Gene. J Phylogenetics Evol Biol. 2014, 4(3). PubMed ID: 28868326

This article shows the identity between SLC9B1 and SLC9B2 and indicates that SLC9B1 originates from SLC9B2.
Kumar P.L. and James P.F. Identification and characterization of methylation-dependent/independent DNA regulatory elements in the human SLC9B1 gene. Gene. 2015, 561(2): 235-48. PubMed ID: 25701605

This article demonstrates that the expression level of SLC9B1 can be regulated by DNA methylation-related mechanisms.
Chintapalli V.R., et al. Transport proteins NHA1 and NHA2 are essential for survival, but have distinct transport modalities. Proc Natl Acad Sci U S A. 2015, 112(37): 11720-5. PubMed ID: 26324901

This article shows that SLC9B1 and SLC9B2 are necessary for cell survival, and show different transporting functions.
Ye G., et al. Cloning of a novel human NHEDC1 (Na+/H+ exchanger like domain containing 1) gene expressed specifically in testis. Mol Biol Rep. 2006, 33(3): 175-80. PubMed ID: 16850186

This article shows SLC9B1 is identified specifically in testis for the first time.

SLC9B1 Preparation Options

Based on our advanced Magic™ membrane protein production platform, our professional senior scientists aim to provide the products with superior quality to our customers and are dedicated to maximizing the success of our clients’ projects. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC9B1 antibody development services.

Creative Biolabs is committed to offering the most superior products to our clients to best facilitate the success of your projects. With years of extensive experience in the field of membrane protein preparation, we are glad to provide customized services as per your requirements. For more detailed information, please feel free to contact us.

Reference

Chintapalli V R, et al. (2015). Transport proteins NHA1 and NHA2 are essential for survival, but have distinct transport modalities. Proc Natl Acad Sci U S A. 112(37): 11720-5.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: