Close

Magic™ Membrane Protein E. coli CCL13 (C-C motif chemokine ligand 13) for Antibody Discovery (CAT#: MP0165X)

This product is a 9 kDa E. coli CCL13 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • E. coli
  • Target Protein
  • CCL13
  • Protein Length
  • Full-length
  • Molecular Weight
  • 9 kDa
  • Sequence
  • MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Product Description

  • Application
  • Functional Study, Functional Study
  • Expression Systems
  • E. coli
  • Tag
  • Escherichia coli
  • Purification
  • Ion exchange column and HPLC reverse phase column
  • Buffer
  • 20 mM PB, 100mM NaCl, pH 7.5

Target

  • Target Protein
  • CCL13
  • Full Name
  • C-C motif chemokine ligand 13
  • Introduction
  • This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis
  • Alternative Names
  • CKb10; MCP-4; MGC17134; NCC-1; NCC1; SCYA13; SCYL1; CK-beta-10; monocyte chemoattractant protein 4; monocyte chemotactic protein 4; new CC chemokine 1; small inducible cytokine A13; small inducible cytokine subfamily A (Cys-Cys), member 13

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us