Close

Magic™ Membrane Protein Human ACKR1 (Atypical chemokine receptor 1 (Duffy blood group)) expressed in E.coli for Antibody Discovery (CAT#: MP1322J)

This product is a 41.1 kDa Human ACKR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACKR1
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.1 kDa
  • TMD
  • 7
  • Sequence
  • MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • E.coli
  • Tag
  • N-10xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ACKR1
  • Full Name
  • Atypical chemokine receptor 1 (Duffy blood group)
  • Introduction
  • The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ACKR1; Atypical chemokine receptor 1; CCBP1; CD234; DARC; Dfy; Duffy antigen/chemokine receptor; duffy blood group; Duffy blood group antigen; Duffy blood group chemokine receptor; DUFFY_HUMAN; FY; Fy glycoprotein; Glycoprotein D; GPD; GpFy; Plasmodium vivax receptor; WBCQ1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us