Close
Close

Magic™ Membrane Protein Human ACKR3 (Atypical chemokine receptor 3) expressed in E.coli for Antibody Discovery (CAT#: MP1324J)

Datasheet
This product is a 57.5 kDa Human ACKR3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACKR3
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 57.5 kDa
  • TMD
  • 7
  • Sequence
  • MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis-SUMO
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ACKR3
  • Full Name
  • Atypical chemokine receptor 3
  • Introduction
  • This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
  • Alternative Names
  • ACKR3; atypical chemokine receptor 3; C X C chemokine receptor type 7; C-X-C chemokine receptor type 7; Chemokine (C-X-C motif) receptor 7; Chemokine C X C motif receptor 7; Chemokine orphan receptor 1; CMKOR1; CXC R7; CXC-R7; CXCR 7; CXCR-7; CXCR7; CXCR7_HUMAN; G protein coupled receptor 159; G protein coupled receptor; G protein coupled receptor RDC1 homolog; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; GPCR RDC1; GPR159; GPRN1; RDC 1; RDC-1; RDC1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us