Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Magic™ Membrane Protein Human AGTR2 (Angiotensin II receptor type 2) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (1-45aa)
"Creative Biolabs is committed to providing highly customized comprehensive solutions with the best quality to advance our global clients’ projects."
Magic™ Membrane Protein Human AGTR2 (Angiotensin II receptor type 2) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (1-45aa) (CAT#: MPX4590K)
This product is a 20.8kDa Human AGTR2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
AGTR2
Protein Length
Partial (1-45aa)
Protein Class
GPCR
Molecular Weight
20.8kDa
TMD
7
Sequence
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Product Description
Expression Systems
E.coli
Tag
6xHis and SUMO tag at the N-terminus
Protein Format
Soluble
Purity
>90% as determined by SDS-PAGE
Buffer
Tris-based buffer, 50% glycerol
Target
Target Protein
AGTR2
Full Name
Angiotensin II receptor type 2
Introduction
The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus and in neonates, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked cognitive disability. Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) and SARS-CoV-2 infection results in down-regulation of angiotensin converting enzyme-2 (ACE2) receptors, the effects of which, triggers serious inflammatory lesions in the tissues involved, primarily in the lungs. The inflammatory reaction appears to be mediated by angiotensin II derivatives, including the angiotensin AT2 receptor which has been found to be upregulated in bronchoalveolar lavage samples from Coronavirus disease 2019 (COVID19) patients.
Alternative Names
AT2; ATGR2; MRX88; angiotensin II type-2 receptor; AGTR2; Angiotensin II receptor type 2