Close
Close

Magic™ Membrane Protein Human AGTR2 (Angiotensin II receptor type 2) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (1-45aa) (CAT#: MPX4590K)

Datasheet
This product is a 20.8kDa Human AGTR2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AGTR2
  • Protein Length
  • Partial (1-45aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 20.8kDa
  • TMD
  • 7
  • Sequence
  • MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • AGTR2
  • Full Name
  • Angiotensin II receptor type 2
  • Introduction
  • The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus and in neonates, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked cognitive disability. Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) and SARS-CoV-2 infection results in down-regulation of angiotensin converting enzyme-2 (ACE2) receptors, the effects of which, triggers serious inflammatory lesions in the tissues involved, primarily in the lungs. The inflammatory reaction appears to be mediated by angiotensin II derivatives, including the angiotensin AT2 receptor which has been found to be upregulated in bronchoalveolar lavage samples from Coronavirus disease 2019 (COVID19) patients.
  • Alternative Names
  • AT2; ATGR2; MRX88; angiotensin II type-2 receptor; AGTR2; Angiotensin II receptor type 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us