Close
Close

Magic™ Membrane Protein Human CCL22 (C-C motif chemokine ligand 22) expressed in E. coli for Antibody Discovery (CAT#: MP0002Q)

Datasheet
This product is a 10.3 kDa Human CCL22 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCL22
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 10.3 kDa
  • Sequence
  • MGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 1 EU/µg
  • Purification
  • Conventional chromatography
  • Purity
  • >95% by SDS - PAGE
  • Buffer
  • PBS, pH 7.4, 10% glycerol

Target

  • Target Protein
  • CCL22
  • Full Name
  • C-C motif chemokine ligand 22
  • Introduction
  • This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology.
  • Alternative Names
  • A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1; C-C motif chemokine 22; CC chemokine STCP-1; chemokine (C-C motif) ligand 22; macrophage-derived chemokine; small inducible cytokine A22; small inducible cytokine subfamily A (Cys-Cys), member 22; MDC(1-69); Small-inducible cytokine A22; Stimulated T-cell chemotactic protein 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us