Close

Magic™ Membrane Protein Human CCR1 (C-C motif chemokine receptor 1) (CAT#: MP0006F)

The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). These chemokines and their receptor mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCR1-C-C Chemokine Receptor type 1-is one of the most prevalent targets for drug development according to the distribution of patents for small molecule inhibitors of chemokine receptors.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR1
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR class A
  • Molecular Weight
  • 41 kDa
  • TMD
  • 7
  • Sequence
  • METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
    QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
    IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
    HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
    IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
    YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

Product Description

  • Activity
  • To be tested
  • Application
  • Screening & display technologies, Antibody development, Structural Biology
  • Expression Systems
  • Cell-free expression system in the presence of lipid vesicles
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >50% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • CCR1
  • Full Name
  • C-C motif chemokine receptor 1
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p.
  • Alternative Names
  • CKR1, CD191, CKR-1, HM145, CMKBR1, MIP1aR, SCYAR1

Customer reviews and Q&As    

Q&As

What is the role of CCR1 in cancer?

CCR1 is overexpressed in several types of cancers, such as hepatocellular carcinoma and breast cancer, and is associated with increased immunosuppressive cell infiltration and metastasis.
2022-12-09

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us