Close

Magic™ Membrane Protein Human CCR2b (C-C motif chemokine receptor 2 inform b) (CAT#: MP0008F)

Also called CCR2 is a member of the beta chemokine receptor family. This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR2b
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 42 kDa
  • TMD
  • 7
  • Sequence
  • MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
    MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
    HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
    CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
    AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
    NPIIYAFVGEKFRRYLSVFFRKHITKRFCKQCPVFYRETVDGVTSTNTPSTGEQEVSAGL

Product Description

  • Activity
  • To be tested
  • Application
  • Screening & Display Technologies, Antibody development, Structural Biology
  • Expression Systems
  • Cell-free expression system in the presence of lipid vesicles
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >40% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • CCR2b
  • Full Name
  • C-C motif chemokine receptor 2 inform b
  • Introduction
  • The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 4.
  • Alternative Names
  • CKR2, CCR-2, CCR2A, CCR2B, CD192, CKR2A, CKR2B, CMKBR2, MCP-1-R, CC-CKR-2

Customer reviews and Q&As    

Q&As

Is CCR2b a target for lupus erythematosus?

A study based on computerized bioinformatics analysis suggests that CCR2 is a potential drug target for lupus erythematosus. The main basis is as follows:
(a) Included as CCLE-DEG (blood and skin) by microarray analysis. The observed upregulation in case vs. control (blood) and lesional vs. non-lesional (skin) are accompanied by low e-values of ≤ 0.05.
(b) Overexpressed in disease vs. control peripheral blood by RT-qPCR analysis, in a separate set of samples as those used in the microarray analysis.
(c) Enriched in lupus-related pathways and processes by ontology enrichment analyses.
(d) "Over-connected" functional molecule by interactome analysis.
(e) A reaction hub by network analysis.
(f) Mapped to chromosome 3 in an overlapping skin/blood transcriptional "hot spot" by chromosome mapping analysis.
(g) Targeted by drugs that are currently being used to treat other diseases such as inflammatory and immune diseases by drug target analysis.
2022-12-13

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us