Close

Magic™ Membrane Protein Human CCR3 (C-C motif chemokine receptor 3) for Antibody Discovery (CAT#: MP1332J)

This product is a 41 kDa Human CCR3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR3
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41 kDa
  • TMD
  • 7
  • Sequence
  • MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR3
  • Full Name
  • C-C motif chemokine receptor 3
  • Introduction
  • The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • B chemokine receptor; b-chemokine receptor; C C chemokine receptor type 3; C C CKR 3; C-C chemokine receptor type 3; C-C CKR-3; CC chemokine receptor 3; CC chemokine receptor type 3; CC CKR 3; CC R3; CC-CKR-3; CCCKR3; CCR 3; CCR-3; CCR3; CCR3_HUMAN; CD 193; CD193; CD193 antigen; Chemokine (C C motif) receptor 3; chemokine (C-C motif) receptor 3; Chemokine (CC) receptor 1 like 2; Chemokine CC motif receptor 3; Chemokine receptor 3; CK R3; CKR 3; CKR3; CMKB R3; CMKBR 3; CMKBR1L2; CMKBR3; Eosinophil CC chemokine receptor 3; Eosinophil eotaxin receptor; Eotaxin receptor; Macrophage inflammatory protein 1 alpha receptor like 2; MGC102841; MIP1 Alpha RL2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us