Close
Close

Magic™ Membrane Protein Human CD40 (CD40 molecule, 21-193aa) with C-hFc for Antibody Discovery (CAT#: MP1483J)

Datasheet
This product is a 46.3 kDa Human CD40 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD40
  • Protein Length
  • Partial (21-193aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 46.3 kDa
  • TMD
  • 1
  • Sequence
  • EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

  • Target Protein
  • CD40
  • Full Name
  • CD40 molecule
  • Introduction
  • Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
  • Alternative Names
  • AI326936; B cell associated molecule CD40; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; p50; Bp50; CD 40; CD40; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40 protein; CD40 type II isoform; CD40L receptor; CDw40; GP39; HIGM1; IGM; IMD3; MGC9013; Nerve growth factor receptor related B lymphocyte activation molecule; OTTHUMP00000031699; OTTHUMP00000031700; p50; T-BAM; TBAM; TNF receptor superfamily member 5; TNFRSF5; TNR5_HUMAN; TRAP; Tumor necrosis factor receptor superfamily, member 5; Tumor necrosis factor receptor superfamily member 5; Tumor necrosis factor receptor superfamily member 5 precursor; Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us