Magic™ Membrane Protein Human CD40 (CD40 molecule) for Antibody Discovery (CAT#: MP1565J)

Datasheet

This product is a 20.2 kDa Human CD40 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
CD40

Protein Length
Partial (21-193aa)

Protein Class
Drug Target

Molecular Weight
20.2 kDa

Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Product Description

Activity
Validated

Expression Systems
Mammalian cell

Tag
C-6xHis

Reconstitution
Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-58% of glycerol (final concentration).

Endotoxin
<1.0 EU/μg

Purity
>95% as determined by SDS-PAGE

Buffer
0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

Target Protein
CD40

Full Name
CD40 molecule

Introduction
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Alternative Names
AI326936; B cell associated molecule CD40; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD 40; CD40; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40 protein; CD40 type II isoform; CD40L receptor; CDw40; GP39; HIGM1; IGM; IMD3; MGC9013; Nerve growth factor receptor related B lymphocyte activation molecule; OTTHUMP00000031699; OTTHUMP00000031700; p50; T-BAM; TBAM; TNF receptor superfamily member 5; TNFRSF5; TNR5_HUMAN; TRAP; Tumor necrosis factor receptor superfamily, member 5; Tumor necrosis factor receptor superfamily member 5; Tumor necrosis factor receptor superfamily member 5 precursor; Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a; p50; Bp50; CDW40; TNFRSF5

Gene ID
958

UniProt ID
P25942

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: