Close

Magic™ Membrane Protein Human CD82 (CD82 molecule) Expressed in HEK293 for Antibody Discovery, Partial (103-225aa) (CAT#: MPX0241K)

This product is a 40.7 kDa Human CD82 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD82
  • Protein Length
  • Partial (103-225aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 40.7 kDa
  • TMD
  • 4
  • Sequence
  • GALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCC
    GWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRT
    QSGNHPEDWPVYQEGCMEKVQAWLQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD82
  • Full Name
  • CD82 molecule
  • Introduction
  • This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Alternative Names
  • CD82; R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27; CD82 antigen; C33 antigen; inducible membrane protein R2; kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); metastasis suppressor Kangai-1; tetraspanin-27; tspan-27; CD82 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us