Close
Close

Magic™ Membrane Protein Human CXCR6 (C-X-C motif chemokine receptor 6) for Antibody Discovery (CAT#: MP1348J)

Datasheet
This product is a 39.3 kDa Human CXCR6 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR6
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.3 kDa
  • TMD
  • 7
  • Sequence
  • MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CXCR6
  • Full Name
  • C-X-C motif chemokine receptor 6
  • Introduction
  • The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the CXC chemokine receptor family. This family also includes CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, and CXCR7. This gene, which maps to the chemokine receptor gene cluster, is expressed in several T lymphocyte subsets and bone marrow stromal cells. The encoded protein and its exclusive ligand, chemokine ligand 16 (CCL16), are part of a signalling pathway that regulates T lymphocyte migration to various peripheral tissues (the liver, spleen red pulp, intestine, lungs, and skin) and promotes cell-cell interaction with dendritic cells and fibroblastic reticular cells. CXCR6/CCL16 also controls the localization of resident memory T lymphocytes to different compartments of the lung and maintains airway resident memory T lymphocytes, which are an important first line of defense against respiratory pathogens. The encoded protein serves as an entry coreceptor used by HIV-1 and SIV to enter target cells, in conjunction with CD4.
  • Alternative Names
  • bonzo; C X C chemokine receptor type 6; C-X-C chemokine receptor type 6; CD 186; CD186; CD186 antigen; CDw186; Chemokine (C X C motif) receptor 6; Chemokine C X C motif receptor 6; Chemokine CXC motif receptor 6; Chemokine receptor 6; CXC chemokine receptor type 6; CXC R6; CXC-R6; CXCR 6; CXCR-6; CXCR6; CXCR6_HUMAN; G protein coupled receptor; G protein coupled receptor bonzo; G protein coupled receptor STRL 33; G protein coupled receptor STRL33; G protein coupled receptor TYMSTR; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; STRL 33; STRL33; TYMSTR

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us