Close

Magic™ Membrane Protein Human DPM3 (Dolichyl-phosphate mannosyltransferase subunit 3, regulatory) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1046K)

This product is a Human DPM3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DPM3
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DPM3
  • Full Name
  • Dolichyl-phosphate mannosyltransferase subunit 3, regulatory
  • Introduction
  • Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a subunit of dolichyl-phosphate mannosyltransferase and acts as a stabilizer subunit of the dolichyl-phosphate mannosyltransferase complex.
  • Alternative Names
  • DPM3; CDG1O; MDDGB15; MDDGC15; dolichol-phosphate mannosyltransferase subunit 3; DPM synthase complex subunit 3; DPM synthase subunit 3; MPD synthase subunit 3; dolichol-phosphate mannose synthase subunit 3; dolichyl-phosphate beta-D-mannosyltransferase subunit 3; dolichyl-phosphate mannosyltransferase polypeptide 3; mannose-P-dolichol synthase subunit 3; prostin 1; testicular tissue protein Li 58; Dolichyl-phosphate mannosyltransferase subunit 3, regulatory

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us