Close

Magic™ Membrane Protein Human EFEMP2 (EGF containing fibulin extracellular matrix protein 2, 1 a.a. - 229 a.a.) for Antibody Discovery (CAT#: MP0321X)

This product is a 52 kDa Human EFEMP2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EFEMP2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 52 kDa
  • Sequence
  • MGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGPRPAGDGPPGVRAGPGDGHHEFPHELPGQLCTEAHRLCRGLHLLRSRREPPSLHLP

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • EFEMP2
  • Full Name
  • EGF containing fibulin extracellular matrix protein 2
  • Introduction
  • A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. Alternatively spliced transcript variants have been identified for this gene
  • Alternative Names
  • FBLN4; MBP1; UPH1; fibulin 4; fibulin-like extracellular matrix protein; mutant p53 binding protein 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us