Close

Magic™ Membrane Protein Human FXYD7 (FXYD domain containing ion transport regulator 7) Full Length (CAT#: MPC0508K) Made to Order

This product is a 8.5 kDa Human FXYD7 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD7
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 8.5 kDa
  • TMD
  • 1
  • Sequence
  • MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
    CRKADSRSESPTCKSCKSELPSSAPGGGGV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FXYD7
  • Full Name
  • FXYD domain containing ion transport regulator 7
  • Introduction
  • This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein.
  • Alternative Names
  • FXYD domain-containing ion transport regulator 7; FXYD7; FXYD domain containing ion transport regulator 7

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us