Close
Close

Magic™ Membrane Protein Human GABRA4 (Gamma-aminobutyric acid type A receptor subunit alpha4) expressed in E.coli for Antibody Discovery (CAT#: MP1380J)

Datasheet
This product is a 41.8 kDa Human GABRA4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GABRA4
  • Protein Length
  • ECD (36-258aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 41.8 kDa
  • Sequence
  • QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis-SUMO
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GABRA4
  • Full Name
  • Gamma-aminobutyric acid type A receptor subunit alpha4
  • Introduction
  • Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. This gene encodes subunit alpha-4, which is involved in the etiology of autism and eventually increases autism risk through interaction with another subunit, gamma-aminobutyric acid receptor beta-1 (GABRB1). Alternatively spliced transcript variants encoding different isoforms have been found in this gene.
  • Alternative Names
  • GABA(A) receptor subunit alpha 4; GABA(A) receptor subunit alpha-4; GABR A4; GABRA 4; Gabra4; Gamma aminobutyric acid (GABA) A receptor alpha 4; Gamma aminobutyric acid A receptor alpha 4; Gamma aminobutyric acid receptor alpha 4 subunit; Gamma aminobutyric acid receptor subunit alpha 4; Gamma-aminobutyric acid receptor subunit alpha-4; GBRA4_HUMAN

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us