Close

Magic™ Membrane Protein Human GRM1 (Glutamate metabotropic receptor 1) Expressed in Wheat germ for Antibody Discovery, Partial (387-486aa) (CAT#: MPX0040K)

This product is a 37 kDa Human GRM1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GRM1
  • Protein Length
  • Partial (387-486aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 37 kDa
  • TMD
  • 7
  • Sequence
  • NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.3% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • GRM1
  • Full Name
  • Glutamate metabotropic receptor 1
  • Introduction
  • This gene encodes a metabotropic glutamate receptor that functions by activating phospholipase C. L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The canonical alpha isoform of the encoded protein is a disulfide-linked homodimer whose activity is mediated by a G-protein-coupled phosphatidylinositol-calcium second messenger system. This gene may be associated with many disease states, including schizophrenia, bipolar disorder, depression, and breast cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • MGLU1; SCA44; GPRC1A; MGLUR1; SCAR13; PPP1R85; glutamate receptor, metabotropic 1; protein phosphatase 1, regulatory subunit 85; GRM1; Glutamate metabotropic receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us