Close

Magic™ Membrane Protein Human KCNE2 (Potassium voltage-gated channel subfamily E regulatory subunit 2) Full Length (CAT#: MPC0360K) Made to Order

This product is a 14.4 kDa Human KCNE2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNE2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 14.4 kDa
  • TMD
  • 1
  • Sequence
  • MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVI
    LYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQI
    LNLEESKATIHENIGAAGFKMSP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNE2
  • Full Name
  • Potassium voltage-gated channel subfamily E regulatory subunit 2
  • Introduction
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.
  • Alternative Names
  • LQT5; LQT6; ATFB4; MIRP1; potassium voltage-gated channel subfamily E member 2; cardiac voltage-gated potassium channel accessory subunit 2; minK-related peptide-1; minimum; potassium ion channel-related peptide 1; potassium channel subunit beta MiRP1; potassium channel subunit, MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; potassium voltage-gated channel, Isk-related family, member 2; voltage-gated K+ channel subunit MIRP1; KCNE2; Potassium voltage-gated channel subfamily E regulatory subunit 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us