Close

Magic™ Membrane Protein Human KCNE3 (Potassium voltage-gated channel subfamily E regulatory subunit 3) Full Length (CAT#: MPC0361K) Made to Order

This product is a 11.7 kDa Human KCNE3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNE3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 11.7 kDa
  • TMD
  • 1
  • Sequence
  • METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASL
    PGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRV
    SMI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNE3
  • Full Name
  • Potassium voltage-gated channel subfamily E regulatory subunit 3
  • Introduction
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the kidney. A missense mutation in this gene is associated with hypokalemic periodic paralysis.
  • Alternative Names
  • HYPP; HOKPP; MiRP2; BRGDA6; potassium voltage-gated channel subfamily E member 3; cardiac voltage-gated potassium channel accessory subunit; minK-related peptide 2; minimum potassium ion channel-related peptide 2; potassium channel subunit beta MiRP2; potassium channel, voltage gated subfamily E regulatory beta subunit 3; potassium voltage-gated channel, Isk-related family, member 3; voltage-gated K+ channel subunit MIRP2; KCNE3; Potassium voltage-gated channel subfamily E regulatory subunit 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us