Close
Close

Magic™ Membrane Protein Human LRP2 (LDL receptor related protein 2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1186-1389aa) (CAT#: MPX4324K)

Datasheet
This product is a 24.2kDa Human LRP2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LRP2
  • Protein Length
  • Partial (1186-1389aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 24.2kDa
  • TMD
  • 1
  • Sequence
  • NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • LRP2
  • Full Name
  • LDL receptor related protein 2
  • Introduction
  • The protein encoded by this gene, low density lipoprotein-related protein 2 (LRP2) or megalin, is a multi-ligand endocytic receptor that is expressed in many different tissues but primarily in absorptive epithilial tissues such as the kidney. This glycoprotein has a large amino-terminal extracellular domain, a single transmembrane domain, and a short carboxy-terminal cytoplasmic tail. The extracellular ligand-binding-domains bind diverse macromolecules including albumin, apolipoproteins B and E, and lipoprotein lipase. The LRP2 protein is critical for the reuptake of numerous ligands, including lipoproteins, sterols, vitamin-binding proteins, and hormones. This protein also has a role in cell-signaling; extracellular ligands include parathyroid horomones and the morphogen sonic hedgehog while cytosolic ligands include MAP kinase scaffold proteins and JNK interacting proteins. Recycling of this membrane receptor is regulated by phosphorylation of its cytoplasmic domain. Mutations in this gene cause Donnai-Barrow syndrome (DBS) and facio-oculoacoustico-renal syndrome (FOAR).
  • Alternative Names
  • DBS; GP330; LRP-2; low-density lipoprotein receptor-related protein 2; Heymann nephritis antigen homolog; calcium sensor protein; glycoprotein 330; megalin; LRP2; LDL receptor related protein 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us