Close

Magic™ Membrane Protein Human MS4A2 (Membrane spanning 4-domains A2) Full Length (CAT#: MPC1110K) Made to Order

This product is a 26.5 kDa Human MS4A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MS4A2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 26.5 kDa
  • TMD
  • 4
  • Sequence
  • MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTW
    LTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGY
    PFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILII
    NLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLT
    ICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • MS4A2
  • Full Name
  • Membrane spanning 4-domains A2
  • Introduction
  • The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of membrane-spanning 4A gene family members. Alternative splicing results in multiple transcript variants encoding distinct proteins. Additional transcript variants have been described but require experimental validation.
  • Alternative Names
  • MS4A2; APY; IGEL; IGER; ATOPY; FCERI; IGHER; MS4A1; FCER1B; high affinity immunoglobulin epsilon receptor subunit beta; Fc fragment of IgE, high affinity I, receptor for; beta polypeptide; High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain); high affinity IgE receptor beta subunit; igE Fc receptor subunit beta; immunoglobulin E receptor, high affinity, beta polypeptide; membrane-spanning 4-domains subfamily A member; Membrane spanning 4-domains A2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us