Close

Magic™ Membrane Protein Human NDUFA2 (NADH:ubiqui oxidoreductase subunit A2) for Antibody Discovery (CAT#: MP0762X)

This product is a 37.3 kDa Human NDUFA2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 37.3 kDa
  • Sequence
  • MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFA2
  • Full Name
  • NADH:ubiqui oxidoreductase subunit A2
  • Introduction
  • The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiqui oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • B8; CD14; CIB8; MC1DN13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; complex I B8 subunit; NADH-ubiquinone oxidoreductase B8 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us