Close

Magic™ Membrane Protein Human NDUFB6 (NADH:ubiqui oxidoreductase subunit B6) for Antibody Discovery (CAT#: MP0776X)

This product is a 39.82 kDa Human NDUFB6 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB6
  • Protein Length
  • Full-length
  • Molecular Weight
  • 39.82 kDa
  • TMD
  • 1
  • Sequence
  • MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFB6
  • Full Name
  • NADH:ubiqui oxidoreductase subunit B6
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiqui oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiqui. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
  • Alternative Names
  • CI; B17; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; CI-B17; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH-ubiquinone oxidoreductase B17 subunit; NADH-ubiquinone oxidoreductase beta subunit, 6; complex I, mitochondrial respiratory chain, B17 subunit; complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us