Close

Magic™ Membrane Protein Human P2RX7 (Purinergic receptor P2X 7) Expressed in Wheat germ, Full Length (CAT#: MPX0012K)

This product is a 85 kDa Human P2RX7 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • P2RX7
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 85 kDa
  • TMD
  • 2
  • Sequence
  • MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-Terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • P2RX7
  • Full Name
  • Purinergic receptor P2X 7
  • Introduction
  • The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria.
  • Alternative Names
  • P2X7; P2X purinoceptor 7; ATP receptor; P2X7 receptor; P2Z receptor; purinergic receptor P2X, ligand gated ion channel, 7; purinergic receptor P2X7 variant A; purnergic receptor P2X 7; P2RX7; Purinergic receptor P2X 7

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us