Close

Magic™ Membrane Protein Human PLA2R1 (Phospholipase A2 receptor 1) Expressed in Baculovirus/Insect expression system with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (395-530aa) (CAT#: MPX4178K)

This product is a 19.3 kDa Human PLA2R1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLA2R1
  • Protein Length
  • Partial (395-530aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 19.3 kDa
  • TMD
  • 1
  • Sequence
  • EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PLA2R1
  • Full Name
  • Phospholipase A2 receptor 1
  • Introduction
  • This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R; secretory phospholipase A2 receptor; 180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; phospholipase A2 receptor 1, 180kD; phospholipase A2 receptor 1, 180kDa; Phospholipase A2 receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us