Close

Magic™ Membrane Protein Human RAMP2 (Receptor activity modifying protein 2) for Antibody Discovery (CAT#: MP1075X)

This product is a 46 kDa Human RAMP2 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RAMP2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 46 kDa
  • TMD
  • 1
  • Sequence
  • MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • RAMP2
  • Full Name
  • Receptor activity modifying protein 2
  • Introduction
  • The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.
  • Alternative Names
  • receptor activity-modifying protein 2; CRLR activity-modifying protein 2; calcitonin receptor-like receptor activity modifying protein 2; receptor (G protein-coupled) activity modifying protein 2; receptor (calcitonin) activity modifying protein 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us