Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Magic™ Membrane Protein Human RHD (Rh blood group D antigen) Expressed in E.coli with 6xHis and GST tag at the N-terminus for Antibody Discovery, Partial (388-417aa)
"Creative Biolabs is committed to providing highly customized comprehensive solutions with the best quality to advance our global clients’ projects."
Magic™ Membrane Protein Human RHD (Rh blood group D antigen) Expressed in E.coli with 6xHis and GST tag at the N-terminus for Antibody Discovery, Partial (388-417aa) (CAT#: MPX4319K)
This product is a 33.6 kDa Human RHD membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
RHD
Protein Length
Partial (388-417aa)
Protein Class
Blood group antigen
Molecular Weight
33.6 kDa
TMD
11
Sequence
LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Product Description
Expression Systems
E.coli
Tag
6xHis and GST tag at the N-terminus
Protein Format
Soluble
Purity
>85% as determined by SDS-PAGE
Buffer
Tris-based buffer, 50% glycerol
Target
Target Protein
RHD
Full Name
Rh blood group D antigen
Introduction
The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
Alternative Names
RHD; RH; Rh4; RH30; RhII; RhPI; DIIIc; RHCED; RHDel; RHPII; RhDCw; CD240D; RHXIII; RHDVA(TT); RhK562-II; blood group Rh(D) polypeptide; D antigen (DCS); RH polypeptide 2; Rh blood group C antigen; Rh blood group CcEe antigen; Rh blood group D antigen weak D type 160; Rh blood group antigen Evans; Rh blood group, D anitgen; RhD antigen; RhD blood group antigen; RhD polypeptide; Rhesus D blood group protein; Rhesus blood group D antigen allele DIII type 7; Rhesus blood group antigen D; Rhesus system D polypeptide; blood group antigen D; blood group protein RHD; rhesus D antigen; truncated Rh blood group D antigen; truncated RhD antigen; truncated rhesus D; truncated rhesus blood group D antigen; Rh blood group D antigen