Close

Magic™ Membrane Protein Human ROPN1 (Rhophilin associated tail protein 1) for Antibody Discovery (CAT#: MP1091X)

This product is a 38.94 kDa Human ROPN1 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ROPN1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.94 kDa
  • Sequence
  • MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • ROPN1
  • Full Name
  • Rhophilin associated tail protein 1
  • Introduction
  • The protein encoded by this gene is found in the fibrous sheath of spermatazoa, where it interacts with rhophilin, a Rho GTPase binding protein. The encoded protein also can bind an A-kinase anchoring protein (AKAP110) and a calcium-binding tyrosine phosphorylation-regulated protein (CABYR). This protein may be involved in sperm motility and has been shown to be a cancer-testis antigen in hematologic malignancies. Several transcript variants, some protein-coding and some non-protein coding, have been found for this gene.
  • Alternative Names
  • CT91; ODF6; ROPN1A; RHPNAP1; ropporin; ropporin-1A; cancer/testis antigen 91; outer dense fiber of sperm tails 6; rhophilin-associated protein 1A; ropporin, rhophilin associated protein 1; testis secretory sperm-binding protein Li 239w

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us