Close

Magic™ Membrane Protein Human RPS19BP1 (Ribosomal protein S19 binding protein 1) (CAT#: MP0002F)

AROS is a direct active regulator of SIRT1, an NAD+-dependent deacetylase. The binding of AROS to the deacetylase upregulate SIRT1. AROS localizes in the nucleus and the cytoplasmic ribosomes. The nuclear protein AROS (also termed 40S ribosomal protein S19-binding protein 1) enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity. Depletion of AROS enhances p21 expression and increases both the G0/G1 population and apoptosis in response to DNA damage, whereas AROS overexpression improves cell survival.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RPS19BP1
  • Protein Length
  • Full Length
  • Protein Class
  • Transcriptional regulator
  • Molecular Weight
  • 15.4 kDa
  • TMD
  • 0
  • Sequence
  • MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSAL
    DEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTV
    FTEEDFQKFQQEYFGS

Product Description

  • Activity
  • To be tested
  • Application
  • Screening & display technologies, Structural biology
  • Expression Systems
  • Cell-free expression system
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Soluble
  • Purification
  • Sucrose gradient
  • Purity
  • >60% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • RPS19BP1
  • Full Name
  • Ribosomal protein S19 binding protein 1
  • Introduction
  • Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.
  • Alternative Names
  • AROS, S19BP

Customer reviews and Q&As    

Q&As

Cytogenetic location of RPS19BP1

The cytogenetic location of RPS19BP1 is 22q13.1.
2022-12-01

Gene function of RPS19BP1

AROS enhanced SIRT1-mediated deacetylation of p53 in vitro in a dose-dependent manner. AROS also enhanced SIRT1 activity in vivo and inhibits p53-mediated transcriptional activity. Both SIRT1 and AROS are required for p53 inactivation. AROS also regulates p53-induced cell growth in response to DNA damage.
2022-12-01

Changes in AROS in non-cirrhotic hepatocellular carcinoma

AROS is commonly expressed in various mouse and human organs, but is overexpressed in cancer cell lines. Related studies have shown that AROS is significantly overexpressed in recurrent tumors compared to non-recurrent tumors. Staging analysis showed higher levels of AROS in tumors at all tumor stages and BCLC stages. In addition, AROS expression varied with advanced tumor staging and vascular infiltration.
2022-12-01

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us