Close

Magic™ Membrane Protein Human STRA6 (Signaling receptor and transporter of retinol STRA6) Expressed in Mammalian cell expression system with hIgG1 FC tag at the C-terminus for Antibody Discovery, Partial (1-50aa) (CAT#: MPX4194K)

This product is a 34.2 kDa Human STRA6 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • STRA6
  • Protein Length
  • Partial (1-50aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 34.2 kDa
  • TMD
  • 10
  • Sequence
  • MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • hIgG1 FC tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • STRA6
  • Full Name
  • Signaling receptor and transporter of retinol STRA6
  • Introduction
  • The protein encoded by this gene is a membrane protein involved in the metabolism of retinol. The encoded protein acts as a receptor for retinol/retinol binding protein complexes. This protein removes the retinol from the complex and transports it across the cell membrane. Defects in this gene are a cause of syndromic microphthalmia type 9 (MCOPS9). Several transcript variants encoding a few different isoforms have been found for this gene.
  • Alternative Names
  • STRA6; MCOPS9; MCOPCB8; PP14296; receptor for retinol uptake STRA6; RBP receptor; retinol binding protein 4 receptor; retinol-binding protein receptor STRA6; stimulated by retinoic acid 6 homolog; stimulated by retinoic acid gene 6 homolog; stimulated by retinoic acid gene 6 protein homolog; UNQ3126/PRO10282/PRO19578; Signaling receptor and transporter of retinol STRA6

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us