Close

Magic™ Membrane Protein Human YWHAH (Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta) for Antibody Discovery (CAT#: MP1401J)

This product is a 54.9 kDa Human YWHAH membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • YWHAH
  • Protein Length
  • Partial (4-246aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 54.9 kDa
  • Sequence
  • REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • YWHAH
  • Full Name
  • Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
  • Introduction
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.
  • Alternative Names
  • 14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us