Close

Magic™ Membrane Protein Mouse Dio1 (Deiodinase, iodothyronine, type I) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1507K)

This product is a Mouse Dio1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Dio1
  • Protein Length
  • Full Length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 1
  • Sequence
  • MGLPQLWLWLKRLVIFLQVALEVAVGKVLMTLFPGRVKQSILAMGQKTGMARNPRFAPDNWVPTFFSIQYFWFVLKVRWQRLEDRAEFGGLAPNCTVVCLSGQKCNIWDFIQGSRPLVLNFGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQERVRAARLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKAGPWNYNPEEVRAVLEKLCTPPRHVPQL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Dio1
  • Full Name
  • Deiodinase, iodothyronine, type I
  • Introduction
  • The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the activation, as well as the inactivation of thyroid hormone by outer and inner ring deiodination, respectively. The activation reaction involves the conversion of the prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4), secreted by the thyroid gland, to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by 5'-deiodination. This protein is expressed predominantly in the liver and kidney and provides most of the circulating T3, which is essential for growth, differentiation and basal metabolism in vertebrates. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal.
  • Alternative Names
  • Dio1; D1; 5DI; ITDI1; TXDI1; type I iodothyronine deiodinase; DIOI; type 1 DI; type-I 5'-deiodinase; Deiodinase, iodothyronine, type I

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us