Mouse Anti-Human Complement C4BPA Polyclonal Antibody(Cat#: CTA-450)

This product is an unconjugated anti-Human Complement C4BPA Polyclonal antibody generated from the Mouse. The antibody can be used for WB.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Mouse
Isotype IgG
Immunogen C4BPA (1 a.a. - 597 a.a.) full-length human protein. MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Species Reactivity Human
Applications WB
Application Notes The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement C4BPA.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 50 µg
Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C4bPA
Alternative Names Complement Component 4 Binding Protein Alpha; Proline-Rich Protein; C4BP; PRP; Complement Component 4-Binding Protein, Alpha; C4b-Binding Protein Alpha Chain; C4bp; C4BP; Complement component 4-binding protein alpha
Gene ID 722
UniProt ID P04003
Information
Introduction C4b-binding protein alpha chain is encoded by the human C4BPA gene. It controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry