Close

Magic™ Membrane Protein Human ATP6V0E2 (ATPase H+ transporting V0 subunit e2) Full Length (CAT#: MPC1757K) Made to Order

This product is a 9.1 kDa Human ATP6V0E2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0E2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 9.1 kDa
  • TMD
  • 2
  • Sequence
  • MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYL
    FWLIAILAQLNPLFGPQLKNETIWYVRFLWE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ATP6V0E2
  • Full Name
  • ATPase H+ transporting V0 subunit e2
  • Introduction
  • Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component.
  • Alternative Names
  • ATP6V0E2; C7orf32; ATP6V0E2L; V-type proton ATPase subunit e 2; H+-ATPase e2 subunit; V-ATPase subunit e 2; V-ATPase subunit e1; lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2; vacuolar proton pump subunit e 2; vacuolar proton-ATPase subunit; ATPase H+ transporting V0 subunit e2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us