Close

Magic™ Membrane Protein Human CCR4 (C-C motif chemokine receptor 4) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (309-360aa) (CAT#: MPX4136K)

This product is a 19.0 kDa Human CCR4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR4
  • Protein Length
  • Partial (309-360aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 19.0 kDa
  • TMD
  • 7
  • Sequence
  • EKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR4
  • Full Name
  • C-C motif chemokine receptor 4
  • Introduction
  • The protein encoded by this gene belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.
  • Alternative Names
  • CKR4; K5-5; CD194; CMKBR4; ChemR13; CC-CKR-4; HGCN:14099; C-C chemokine receptor type 4; C-C CKR-4; CCR-4; chemokine (C-C motif) receptor 4; chemokine (C-C) receptor 4; CCR4; C-C motif chemokine receptor 4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us