Close

Magic™ Membrane Protein Human CCR5 (C-C motif chemokine receptor 5) (CAT#: MP0009F)

CCR5 is a receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates. CCR5 is G protein-coupled receptor (GPCR) which regulates trafficking and effector functions of memory/effector T-lymphocytes, macrophages, and immature dendritic cells. It also serves as the main coreceptor for the entry of R5 strains of human immunodeficiency virus (HIV-1, HIV-2).

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR5
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 40 kDa
  • TMD
  • 7
  • Sequence
  • MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
    LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
    LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
    HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
    MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
    GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Product Description

  • Activity
  • To be tested
  • Application
  • Screening & display technologies
  • Expression Systems
  • Cell-free expression system in the presence of lipid vesicles
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >50% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • CCR5
  • Full Name
  • C-C motif chemokine receptor 5
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • CKR5, CCR-5, CD195, CKR-5, CCCKR5, CMKBR5, IDDM22, CC-CKR-5

Customer reviews and Q&As    

Q&As

What are the roles of CCR5 in cancer?

CCR5 induces the homing of cancer cells to metastases, enhances the pro-inflammatory pro-metastatic immune phenotype, and enhances DNA repair, providing abnormal cell survival and resistance to DNA damaging agents.
2022-12-15

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us