Magic™ Membrane Protein Human CCR5 (C-C motif chemokine receptor 5) for Antibody Discovery (CAT#: MP1334J)

Datasheet

This product is a 43.9 kDa Human CCR5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
CCR5

Protein Length
Full-length

Protein Class
GPCR

Molecular Weight
43.9 kDa

Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Product Description

Expression Systems
E.coli

Tag
N-10xHis

Reconstitution
Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).

Purity
>85% as determined by SDS-PAGE

Buffer
Liquid: Tris/PBS-based buffer, 5%-50% glycerol
Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

Target Protein
CCR5

Full Name
C-C motif chemokine receptor 5

Introduction
This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene.

Alternative Names
AM4 7; C C chemokine receptor type 5; C C CKR 5; C-C chemokine receptor type 5; C-C CKR-5; C-C motif chemokine receptor 5 A159A; CC Chemokine Receptor 5; CC Chemokine Receptor Type 5; CC CKR 5; CC-CKR-5; CCCKR 5; CCCKR5; CCR 5; CCR-5; CCR5; CCR5 chemokine (C C motif) receptor 5; CCR5_HUMAN; CD 195; CD195; CD195 Antigen; Chemokine C C motif receptor 5; Chemokine receptor CCR5; CHEMR13; CKR 5; CKR5; CMKBR 5; CMKBR5; FLJ78003; HIV 1 Fusion Coreceptor; HIV-1 fusion coreceptor; HIV1 fusion coreceptor; IDDM22; MIP-1 alpha receptor

Gene ID
1234

UniProt ID
P51681

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: