Close

Magic™ Membrane Protein Human CD36 (CD36 molecule) expressed in Sf9 for Antibody Discovery (CAT#: MP0076Q)

This product is a 53 kDa Human CD36 membrane protein expressed in Sf9. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD36
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 53 kDa
  • TMD
  • 2
  • Sequence
  • MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG
    VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Product Description

  • Expression Systems
  • Sf9
  • Tag
  • His
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 20mM 1 x PBS pH7.6, 150mM NaCl, 20% glycerol

Target

  • Target Protein
  • CD36
  • Full Name
  • CD36 molecule
  • Introduction
  • The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3; platelet glycoprotein 4; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule (thrombospondin receptor); GPIIIB; GPIV; CD36; Thrombospondin receptor; PAS-4; Platelet collagen receptor; PAS-4 protein; cluster determinant 36; fatty acid translocase; glycoprotein IIIb; leukocyte differentiation antigen CD36; platelet glycoprotein IV; scavenger receptor class B, member 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us