Close

Magic™ Membrane Protein Human GPRC5C (G protein-coupled receptor class C group 5 member C) Expressed in Wheat germ for Antibody Discovery, Partial (387-486aa) (CAT#: MPX0038K)

This product is a 41 kDa Human GPRC5C membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPRC5C
  • Protein Length
  • Partial (387-486aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41 kDa
  • TMD
  • 7
  • Sequence
  • AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • GPRC5C
  • Full Name
  • G protein-coupled receptor class C group 5 member C
  • Introduction
  • The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • RAIG3; RAIG-3; G-protein coupled receptor family C group 5 member C; orphan G-protein coupled receptor; retinoic acid responsive gene protein; retinoic acid-induced gene 3 protein; GPRC5C; G protein-coupled receptor class C group 5 member C

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us