Close

Magic™ Membrane Protein Human KCNMA1 (Potassium calcium-activated channel subfamily M alpha 1) for Antibody Discovery (CAT#: MP1410J)

This product is a 20 kDa Human KCNMA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNMA1
  • Protein Length
  • Partial (411-560aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 20 kDa
  • Sequence
  • VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • C-6xHis-HPC4
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNMA1
  • Full Name
  • Potassium calcium-activated channel subfamily M alpha 1
  • Introduction
  • MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • subfamily M subunit alpha-1; BK channel; BKCA alpha; BKCA alpha subunit; BKTM; Calcium-activated potassium channel; Calcium-activated potassium channel subunit alpha-1; Drosophila slowpoke like; hSlo; K(VCA)alpha; KCa1.1; KCMA1_HUMAN; KCNMA; KCNMA1; Maxi K channel; Maxi Potassium channel alpha; MaxiK; SAKCA; SLO alpha; SLO; Slo homolog; Slo-alpha; Slo1; Slowpoke homolog

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us