Close

Magic™ Membrane Protein Human KLRC1 (Killer cell lectin like receptor C1) Full Length (CAT#: MPC2218K) Made to Order

This product is a 26.3 kDa Human KLRC1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRC1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 26.3 kDa
  • TMD
  • 1
  • Sequence
  • MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQ
    DFQGNDKTYHCKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQR
    HNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSK
    NSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKD
    SDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • StrepII and Flag tag at the N-terminus
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KLRC1
  • Full Name
  • Killer cell lectin like receptor C1
  • Introduction
  • Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
  • Alternative Names
  • KLRC1; NKG2; NKG2A; CD159A; NKG2-A/NKG2-B type II integral membrane protein; C-lectin type II protein; CD159 antigen-like family member A; NK cell receptor A; NKG2-1/B activating NK receptor; NKG2-A/B type II integral membrane protein; NKG2-A/B-activating NK receptor; killer cell lectin-like receptor subfamily C, member 1; natural killer cell lectin; natural killer group protein 2; Killer cell lectin like receptor C1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us