Close

Magic™ Membrane Protein Human MAL (Mal, T cell differentiation protein, transcript variant d) for Antibody Discovery (CAT#: MP0416J)

This product is a 5.8 kDa Human MAL membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MAL
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 5.8 kDa
  • Sequence
  • MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFVFSYIATLLYVVHAVFSLIRWKSS

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • MAL
  • Full Name
  • Mal, T cell differentiation protein
  • Introduction
  • The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3.
  • Alternative Names
  • T-cell differentiation protein MAL; T-lymphocyte maturation-associated protein; myelin and lymphocyte protein; mal, T-cell differentiation protein; MVP17; VIP17; T-lymphocyte maturation-associated protein

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us