Close

Magic™ Membrane Protein Human MYC (MYC proto-oncogene, bHLH transcription factor, 184-454aa) for Antibody Discovery (CAT#: MP1522J)

This product is a 61.7 kDa Human MYC membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MYC
  • Protein Length
  • Partial (184-454aa)
  • Protein Class
  • Drug Target
  • Molecular Weight
  • 61.7 kDa
  • Sequence
  • SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • MYC
  • Full Name
  • MYC proto-oncogene, bHLH transcription factor
  • Introduction
  • This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
  • Alternative Names
  • AU016757; Avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; Cellular myelocytomatosis oncogene; Class E basic helix-loop-helix protein 39; MGC105490; MRTL; Myc; Myc protein; Myc proto oncogene protein; Myc proto-oncogene protein; myc-related translation/localization regulatory factor; MYC_HUMAN; Myc2; myca; MYCC; Myelocytomatosis oncogene a; Myelocytomatosis oncogene; Niard; Nird; oncogene c-Myc; Oncogene Myc; OTTHUMP00000158589; OTTHUMP00000227763; Proto-oncogene c-Myc; Protooncogene homologous to myelocytomatosis virus; RNCMYC; Transcription factor p64; Transcriptional regulator Myc-A; V-Myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog (avian); zc-myc; MRTL

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us