Close

Magic™ Membrane Protein Human NPHS1 (NPHS1 adhesion molecule, nephrin) Expressed in Mammalian cell expression system with 10xHis tag at the N-terminus for Antibody Discovery, Partial (23-257aa) (CAT#: MPX4688K)

This product is a 27.5 kDa Human NPHS1 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NPHS1
  • Protein Length
  • Partial (23-257aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 27.5 kDa
  • TMD
  • 1
  • Sequence
  • QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEW

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • NPHS1
  • Full Name
  • NPHS1 adhesion molecule, nephrin
  • Introduction
  • This gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found at the slit diaphragm of glomerular podocytes. The slit diaphragm is thought to function as an ultrafilter to exclude albumin and other plasma macromolecules in the formation of urine. Mutations in this gene result in Finnish-type congenital nephrosis 1, characterized by severe proteinuria and loss of the slit diaphragm and foot processes.
  • Alternative Names
  • NPHS1; CNF; NPHN; nephrin; nephrin; NPHS1, nephrin; nephrosis 1, congenital, Finnish type (nephrin); renal glomerulus-specific cell adhesion receptor; truncated NPHS1; NPHS1 adhesion molecule, nephrin

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us