Close

Magic™ Membrane Protein Human RAMP1 (Receptor activity modifying protein 1) Full Length (CAT#: MPC1063K) Made to Order

This product is a 16.9 kDa Human RAMP1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RAMP1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 16.9 kDa
  • TMD
  • 1
  • Sequence
  • MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEA
    VGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRY
    FRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • RAMP1
  • Full Name
  • Receptor activity modifying protein 1
  • Introduction
  • The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • RAMP1; CRLR activity-modifying protein 1; calcitonin receptor-like receptor activity modifying protein 1; receptor (G protein-coupled) activity modifying protein 1; receptor (calcitonin) activity modifying protein 1; receptor activity-modifying protein 1; Receptor activity modifying protein 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us