Close

Magic™ Membrane Protein Human SLAMF6 (SLAM family member 6) without tag for Antibody Discovery (CAT#: MP1137X)

This product is a 30.5 kDa Human SLAMF6 membrane protein expressed in In vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLAMF6
  • Protein Length
  • Full-length
  • Molecular Weight
  • 30.5 kDa
  • TMD
  • 1
  • Sequence
  • MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • In vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • No
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • SLAMF6
  • Full Name
  • SLAM family member 6
  • Introduction
  • The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000; SLAM family member 6; NK-T-B-antigen; NTBA receptor; activating NK receptor; natural killer-, T- and B-cell antigen

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us