Close

Magic™ Membrane Protein Mouse Atp5g3 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1004K)

This product is a Mouse Atp5g3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Atp5g3
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 2
  • Sequence
  • DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Atp5g3
  • Full Name
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
  • Introduction
  • The protein encoded by this gene is a subunit of mitochondrial membrane ATP synthase, the enzyme that catalyzes ATP synthesis during oxidative phosphorylation. This gene encodes subunit 9, which is present in multiple copies in the transmembrane part of the ATP synthase complex. Phenotype and gene expression profiles suggest correlations between this gene and alcoholism- and obesity-related phenotypes. Alternative splicing results in multiple transcript variants and protein isoforms.
  • Alternative Names
  • Atp5g3; Atp5mc3; 6030447M23; ATP synthase F(0) complex subunit C3, mitochondrial; ATP synthase lipid-binding protein, mitochondrial; ATP synthase membrane subunit c locus 3; ATP synthase proteolipid P3; ATPase protein 9; ATPase subunit c; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us