TMBIM6 Membrane Protein Introduction

Introduction of TMBIM6

Human Bax inhibitor-1 (BI-1) is an anti-apoptotic integral membrane protein, mainly located in the intracellular membranes of the endoplasmic reticulum (ER). BI-1 has been identified as an inhibitor of Bax-mediated cell death in yeast. Studies of BI-1 are now extending to include the BI-1 protein family. Therefore, BI-1 was recently re-named as TMBIM6 because it is part of the transmembrane Bax inhibitor-1-containing motif family. Genetic and bioinformatics studies have shown that members of the TMBIM family are highly conserved across species and may have a common ancestor in yeast. TMBIM1/RECS1 (responsive to centrifugal force and shear stress gene 1 protein) has a lysosomal, Golgi, and plasma membrane cellular distribution, and it interacts with and inhibits Fas ligand-mediated apoptosis.

Basic Information of TMBIM6
Protein Name	Bax inhibitor 1
Gene Name	TMBIM6
Aliases	BI-1, Testis-enhanced gene transcript protein, Transmembrane BAX inhibitor motif-containing protein 6, BI1, TEGT
Organism	Homo sapiens (Human)
UniProt ID	P55061
Transmembrane Times	6
Length (aa)	237
Sequence	MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK

Function of TMBIM6 Membrane Protein

The functions of BI-1 in diseases, such as diabetes, ischemia, liver regeneration, and cancer, has been studied in different physio/pathological models. These physiological mechanisms have been applied to clinically relevant studies concerning Ca²⁺ regulations and ER stress. The expression of BI-1 in mammalian cells suppresses apoptosis induced by Bax, a pro-apoptotic member of the Bcl-2 family. BI-1 has been shown to be related to Ca²⁺ levels, reactive oxygen species (ROS) production, cytosolic acidification, and autophagy, as well as endoplasmic reticulum stress, signaling pathways. BI-1 promotes the characteristics of cancers. In addition, BI-1 has also been shown to regulate insulin resistance, hepatic dysfunction, adipocyte differentiation, and depression.

TMBIM6 Membrane Protein Introduction Fig.1 BI-1 protects against ER stress-induced apoptosis. (Li, 2011)

Application of TMBIM6 Membrane Protein in Literature

Lu B., et al. Bax inhibitor-1 is overexpressed in non-small cell lung cancer and promotes its progression and metastasis. Int J Clin Exp Pathol. 2015, 8(2): 1411-8. PubMed ID: 25973025

The article reveals that BI-1 is overexpressed in human non-small cell lung cancer (NSCLC) and promotes the progression and metastasis of NSCLC.
Chen Y., et al. The Bax inhibitor MrBI-1 regulates heat tolerance, apoptotic-like cell death, and virulence in Metarhizium robertsii. Sci Rep. 2016, 5: 10625. PubMed ID: 26023866

The article reports that MrBI-1 could partially rescue mammalian Bax-induced cell death in yeast, promoting the understanding of BI-1-like protein functions in filamentous fungi.
Çakır B., et al. Arabidopsis Bax Inhibitor-1 inhibits cell death induced by pokeweed antiviral protein in Saccharomyces cerevisiae. Microb Cell. 2015, 2(2): 43-56. PubMed ID: 28357275

Authors in this group studied the interaction between PAP and AtBI-1 (Arabidopsis thaliana Bax Inhibitor-1). The results showed that AtBI-1 inhibited cell death induced by PAP without affecting ribosome depurination and translation inhibition.
Lee M.R., et al. BAX inhibitor-1-associated V-ATPase glycosylation enhances collagen degradation in pulmonary fibrosis. Cell Death Dis. 2014, 5: e1113. PubMed ID: 24625972

The article highlights the regulatory role of BI-1 in idiopathic pulmonary fibrosis (IPF) and reveals for the first time the role of lysosomal V-ATPase glycosylation in IPF.
Nagano M., et al. Arabidopsis Bax inhibitor-1 promotes sphingolipid synthesis during cold stress by interacting with ceramide-modifying enzymes. Planta. 2014, 240(1): 77-89. PubMed ID: 24687220

The article reports that AtBI-1 contributes to synthesis of sphingolipids during cold stress by interacting with AtSLD1, AtFAH1, AtSBH2, and AtADS2.

TMBIM6 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMBIM6 antibody development services.

As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and help you with the research of membrane proteins. Please do not hesitate to inquire us for more details.

Reference

Li B, et al. (2011). The characteristics of Bax inhibitor-1 and its related diseases. Curr Mol Med. 14(5), 603-15.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: